PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EMT25287
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Triticinae; Aegilops
Family MYB_related
Protein Properties Length: 260aa    MW: 29325.9 Da    PI: 8.6096
Description MYB_related family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EMT25287genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding38.33.1e-1297141347
                      SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                       WT eE+  ++ + + +G g+Wk I++++ +++t+ q+ s+ qky
         EMT25287  97 FWTDEEHRSFLYGLEVYGRGDWKNISKHFVTTKTPVQVSSHAQKY 141
                      6*******************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.65390146IPR017930Myb domain
SuperFamilySSF466891.22E-1694147IPR009057Homeodomain-like
SMARTSM007171.7E-894144IPR001005SANT/Myb domain
Gene3DG3DSA:1.10.10.603.6E-996148IPR009057Homeodomain-like
PfamPF002496.8E-998141IPR001005SANT/Myb domain
CDDcd001671.99E-998142No hitNo description
TIGRFAMsTIGR015574.3E-1498144IPR006447Myb domain, plants
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 260 aa     Download sequence    Send to blast
MEVNQGWTSS EVEEACSLIA RLKTNKIMYD DNDDKNKKHN YIVNSLHALF PSKTMKQNTG  60
ITVTGEAPLM ADNNKMKMLE NNISIDQPVV APHQWGFWTD EEHRSFLYGL EVYGRGDWKN  120
ISKHFVTTKT PVQVSSHAQK YFKRIEKKAS SRTKRYSIND VRLHDNELLA ANNSSAPGQT  180
LSFTSLNNDP SFRLQAPTSS FTVMNNLAQC SPSIYNQQVG QQPMWREQQM MGSTAPVMGG  240
VGNYVPDGQQ GSAYFYLANV
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010229928.14e-58PREDICTED: uncharacterized protein LOC104582232
TrEMBLM8CDV00.0M8CDV0_AEGTA; Myb-like protein J
STRINGMLOC_51337.21e-114(Hordeum vulgare)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP84230133
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G10580.22e-22MYB_related family protein